PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim09g005370.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 101aa    MW: 11209.8 Da    PI: 10.0126
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim09g005370.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.79.4e-272373151
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                        k+rl+Wt+eLH+ F +av+qLGG+e+AtPk il++m++ gLt+ hvkSHLQ
  Sopim09g005370.0.1 23 KERLKWTQELHDLFEKAVSQLGGPERATPKGILKVMGISGLTIFHVKSHLQ 73
                        68************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.1812080IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-242173IPR009057Homeodomain-like
SuperFamilySSF466892.33E-142275IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-212374IPR006447Myb domain, plants
PfamPF002499.8E-92573IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MPGEFREQPS SSMASNRSDG SSKERLKWTQ ELHDLFEKAV SQLGGPERAT PKGILKVMGI  60
SGLTIFHVKS HLQLASLKGE AYQKFYQTSV LQRELLFNSL *
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-73HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755211e-73HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015086813.11e-46PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ8GUN53e-19PHL1_ARATH; Protein PHR1-LIKE 1
SwissprotQ9SAK52e-19APL_ARATH; Myb family transcription factor APL
TrEMBLK4CQ272e-68K4CQ27_SOLLC; Uncharacterized protein
STRINGSolyc09g005370.1.14e-68(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101012026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.16e-25G2-like family protein